NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Iso3TCLC_10078845

Scaffold Iso3TCLC_10078845


Overview

Basic Information
Taxon OID3300002821 Open in IMG/M
Scaffold IDIso3TCLC_10078845 Open in IMG/M
Source Dataset NameIso-alkanes.Hi.seq-Iso3T
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMcGill University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1153
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location
Location NameAthabasca Oil Sands, Alberta Canada
CoordinatesLat. (o)57.02Long. (o)-111.65Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F088355Metagenome / Metatranscriptome109Y

Sequences

Protein IDFamilyRBSSequence
Iso3TCLC_100788451F088355AGGAGMKDIKNKVSVFAGQKGQLVLAILTIALFVLAAGAPNATIGIGR*
Iso3TCLC_100788453F088355AGGAGMKNIKNKVSVFAGQKGQLVLAILTIALFVLAAGAPNATIGIGR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.