Scaffold JGIcombinedJ43158_10002263

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGIcombinedJ43158_10002263

Scaffold JGIcombinedJ43158_10002263

Overview

Basic Information
Taxon OID	3300002839 Open in IMG/M
Scaffold ID	JGIcombinedJ43158_10002263 Open in IMG/M
Source Dataset Name	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 11-31A and 11-33A (Combined assembly, ASSEMBLY_DATE=20140611)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	11936
Total Scaffold Genes	15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	12 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location
Location Name	Barrow, Alaska, USA
Coordinates	Lat. (^o)	71.290884	Long. (^o)	-156.788063	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090156	Metagenome	108	Y

Sequences

Protein ID	Family	RBS	Sequence
JGIcombinedJ43158_1000226314	F090156	GAG	MSDNEQPLELSAELRGEVSALFAPMDRSLAGSVTAAIGMRRSRRRLLQGLWLGFSPVMAVAIVAVLYVGGAVLPRTLSLATSKRAAFAPNAEIRAQDTGPNGLVGSENFPTFATACRAPSFRVVLEGDVARRQLLVTWLRGRHADVALELATAVPGRDVALTLEPDEVQGFVALMVLHGFTGQEPSGLRIVARRSPTSWASSLGTSSLFICLIP*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.