Basic Information | |
---|---|
Taxon OID | 3300002950 Open in IMG/M |
Scaffold ID | JGI26053J44789_1019552 Open in IMG/M |
Source Dataset Name | High solid enriched microbial communities from the Joint BioEnergy Institute, USA - SP1-5-D |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 669 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched → Ionic Liquid And High Solid Enriched Microbial Communities From The Joint Bioenergy Institute, California, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Joint BioEnergy Institute, California, USA | |||||||
Coordinates | Lat. (o) | 38.5402 | Long. (o) | -121.75 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F010514 | Metagenome | 302 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI26053J44789_10195521 | F010514 | N/A | KKIIVPNSVHIRPGQENSEKYSKKIQKIIKPLPSIIFSQNGMR* |
⦗Top⦘ |