NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI26052J44787_1015014

Scaffold JGI26052J44787_1015014


Overview

Basic Information
Taxon OID3300002951 Open in IMG/M
Scaffold IDJGI26052J44787_1015014 Open in IMG/M
Source Dataset NameHigh solid enriched microbial communities from the Joint BioEnergy Institute, USA - SP1-4-D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)842
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched → Ionic Liquid And High Solid Enriched Microbial Communities From The Joint Bioenergy Institute, California, Usa

Source Dataset Sampling Location
Location NameJoint BioEnergy Institute, California, USA
CoordinatesLat. (o)38.5402Long. (o)-121.75Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038929Metagenome / Metatranscriptome164Y

Sequences

Protein IDFamilyRBSSequence
JGI26052J44787_10150141F038929N/AIGQKIEKKNNFLPIRSNPARVRKFKNKCKKILKIKKHHPGFISRRNGSGQA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.