NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold soap12_1000504

Scaffold soap12_1000504


Overview

Basic Information
Taxon OID3300002977 Open in IMG/M
Scaffold IDsoap12_1000504 Open in IMG/M
Source Dataset NameBiogas reactor microbial communities from Swedish University of Agricultural Sciences, Alnarp, Sweden
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1006
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → unclassified Mycoplasmatota → Tenericutes bacterium ADurb.Bin239(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Biotransformation → Unclassified → Unclassified → Unclassified → Biogas Reactor → Biogas Reactor Microbial Communities From Swedish University Of Agricultural Sciences, Alnarp, Sweden, And As, Norway That Are Enriched On Cellulose

Source Dataset Sampling Location
Location NameSLU, Alnarp, Sweden
CoordinatesLat. (o)55.656904Long. (o)13.082968Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F103990Metagenome101Y

Sequences

Protein IDFamilyRBSSequence
soap12_10005041F103990N/AGCIGLKSSNILNQKQKDKINEVVRLITIEKRLGKTSITKEDADFVKALSDTKHYPRAEYVLARMYLCGYQIEQDKTMGMKYLARSSRHAGYDLQLKIAYMYHVLGETKTIKECLKSARDDCI*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.