Scaffold FeGlu_10093431

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold FeGlu_10093431

Scaffold FeGlu_10093431

Overview

Basic Information
Taxon OID	3300002988 Open in IMG/M
Scaffold ID	FeGlu_10093431 Open in IMG/M
Source Dataset Name	Fe-reducing enrichment culture from wetland sample 1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	971
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Wetland Sediment → Wetland Sediment Microbial Communities From Dorn Creek, Dane County, Wisconsin, Usa, Enriched For Fe-Cycling Cultures

Source Dataset Sampling Location
Location Name	Dorn Creek (Dane County, WI)
Coordinates	Lat. (^o)	43.135131	Long. (^o)	-89.441777	Alt. (m)		Depth (m)	0 to .3048
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042358	Metagenome / Metatranscriptome	158	Y

Sequences

Protein ID	Family	RBS	Sequence
FeGlu_100934312	F042358	AGGAG	MTDDAPWSAYMALDGPHLDGLIGSAGVLRFDWPERKFYFQHFEGISAAHNVSIARNAQLALLGNFSQQIVVLDITKADRIREVRRQSTMYFEQTAYRLRSNTHHLWEPDNQHFIGAIGDHLYRFDVDDLKAPEXXXXXXXCGGTPRAAIS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.