NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold FeGlu_10291682

Scaffold FeGlu_10291682


Overview

Basic Information
Taxon OID3300002988 Open in IMG/M
Scaffold IDFeGlu_10291682 Open in IMG/M
Source Dataset NameFe-reducing enrichment culture from wetland sample 1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)814
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Wetland Sediment → Wetland Sediment Microbial Communities From Dorn Creek, Dane County, Wisconsin, Usa, Enriched For Fe-Cycling Cultures

Source Dataset Sampling Location
Location NameDorn Creek (Dane County, WI)
CoordinatesLat. (o)43.135131Long. (o)-89.441777Alt. (m)Depth (m)0 to .3048
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F046478Metagenome / Metatranscriptome151N

Sequences

Protein IDFamilyRBSSequence
FeGlu_102916821F046478N/AMLAADVNCFWALEQDQESYNREVYLPDAYIEVIINVGAPLVLESEHGMLELPRAFVNPLQNKPLRIRAAGFCQMISMQLYPWA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.