Basic Information | |
---|---|
Taxon OID | 3300002988 Open in IMG/M |
Scaffold ID | FeGlu_10557464 Open in IMG/M |
Source Dataset Name | Fe-reducing enrichment culture from wetland sample 1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 867 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Wetland Sediment → Wetland Sediment Microbial Communities From Dorn Creek, Dane County, Wisconsin, Usa, Enriched For Fe-Cycling Cultures |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Dorn Creek (Dane County, WI) | |||||||
Coordinates | Lat. (o) | 43.135131 | Long. (o) | -89.441777 | Alt. (m) | Depth (m) | 0 to .3048 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F055797 | Metagenome / Metatranscriptome | 138 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
FeGlu_105574642 | F055797 | N/A | IQAPFVLAEIRALRSSIFKKTQEVQTALAVADKVEQSYDLHRADLFIPAGDTWCAILDPFAMTVLTGTLRRIGYEIFPQYVQILGIQPANVRTAMDLKVPADLVRTICEAYSRCVVGEDAGTLSPEVQGSTVTVTDSTIIPCQLQMGVFLGAGKLTGLFRENVLVEKRCRNKGDSVCTYEFVF* |
⦗Top⦘ |