Scaffold Ga0052265_110637

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0052265_110637

Scaffold Ga0052265_110637

Overview

Basic Information
Taxon OID	3300003128 Open in IMG/M
Scaffold ID	Ga0052265_110637 Open in IMG/M
Source Dataset Name	Acid mine drainage microbial communities from Los Rueldos abandoned Hg mine in Spain - Sample B1A
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Institute of Catalysis, The Higher Council for Scientific Research (CSIC)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1056
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Acid Mine Drainage → Acid Mine Drainage → Acid Mine Drainage Microbial Communities From Los Rueldos Abandoned Hg Mine In Spain

Source Dataset Sampling Location
Location Name	Vally of Mogao stream, Los Rueldos site, NW Spain
Coordinates	Lat. (^o)	43.25	Long. (^o)	-5.7666667	Alt. (m)		Depth (m)	.03 to .5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013397	Metagenome / Metatranscriptome	271	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0052265_1106372	F013397	GGAG	MTSIAATLGIRERLRQRVLPHHEAWRRQDEYAGGCLCDGCGERSTSARASYEVDFSPDVTPQSVKLHRARVKIWQYEGESPPIS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.