Scaffold Ga0052246_1034077

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0052246_1034077

Scaffold Ga0052246_1034077

Overview

Basic Information
Taxon OID	3300003141 Open in IMG/M
Scaffold ID	Ga0052246_1034077 Open in IMG/M
Source Dataset Name	Marine sediment microbial communities from deep subseafloor of Shimokita Peninsula, Japan - 107 mbsf
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Japan Agency for Marine-Earth Science and Technology
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	702
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Petrotoga → Petrotoga mobilis	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From Deep Subseafloor

Source Dataset Sampling Location
Location Name	Shimokita Peninsula, Japan, in Northwestern Pacific
Coordinates	Lat. (^o)	41.1773	Long. (^o)	142.2013	Alt. (m)		Depth (m)	1180.5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069660	Metagenome / Metatranscriptome	123	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0052246_10340771	F069660	GAG	MGLTNILKLLGIVGGIIPIILTLIKEIEIPGWGKEKKQAILDAISLFYDKISEGNTLPITKEKLLGIAGGFVDIVVGFFNLVGWFKHGSPTVSS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.