Scaffold P32013IDBA_1042048

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold P32013IDBA_1042048

Scaffold P32013IDBA_1042048

Overview

Basic Information
Taxon OID	3300003313 Open in IMG/M
Scaffold ID	P32013IDBA_1042048 Open in IMG/M
Source Dataset Name	Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P3 sample
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Campinas
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1314
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Ore Pile And Mine Drainage Contaminated Soil → Ore Pile And Mine Drainage Contaminated Soil Microbial Communities From Mina Do Sossego, Brazil, In A Copper Mine

Source Dataset Sampling Location
Location Name	Mina do Sossego, Brazil
Coordinates	Lat. (^o)	-6.426389	Long. (^o)	-50.051389	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066113	Metagenome / Metatranscriptome	127	Y

Sequences

Protein ID	Family	RBS	Sequence
P32013IDBA_10420482	F066113	AGGA	MSPEFPIRILTDDGECEVLDSPEELMARLHDFDSSDPRVWVRDAYDRTVRIVVRGGVVEVFDVAGSG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.