Scaffold BeaverFeces_1076094

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold BeaverFeces_1076094

Scaffold BeaverFeces_1076094

Overview

Basic Information
Taxon OID	3300003472 Open in IMG/M
Scaffold ID	BeaverFeces_1076094 Open in IMG/M
Source Dataset Name	Beaver gut microbial communities from British Columbia, Canada - Beaver Fecal Sample 1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Genome Quebec
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2299
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (16.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Beaver Gut → Beaver Gut Microbial Communities From British Columbia, Canada

Source Dataset Sampling Location
Location Name	Canada: Langley Township, British Columbia
Coordinates	Lat. (^o)	49.01063	Long. (^o)	-122.625468	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069970	Metagenome	123	Y

Sequences

Protein ID	Family	RBS	Sequence
BeaverFeces_10760942	F069970	N/A	MTTQHTAINVGDKVTFDNDKIEIFKAETSSDDMAVRQYQQLVLGGIDQVGVVKELGGNLTTVSYPDGWDLPVPTKYLIVLPSE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.