Basic Information | |
---|---|
Taxon OID | 3300003485 Open in IMG/M |
Scaffold ID | JGI26527J51213_1028687 Open in IMG/M |
Source Dataset Name | Wastewater bioreactor microbial communities from Cape Town, South Afric - Thiocy_cont_300_biof |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1198 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | South Africa: Cape Town | |||||||
Coordinates | Lat. (o) | -33.936637 | Long. (o) | 18.478905 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F094111 | Metagenome | 106 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI26527J51213_10286872 | F094111 | N/A | LTLSYNQPRFCLNTIWNSIATSFADQSFLGTDPHGIFVNSNNSIYIPNRQTGQIYIWQNENHLNPTKTIIYVDNGQYNGRVDKWIVENETWISVMNATSPCFGLFIDIYENLYCSMFYNHRVDKKWSNSIISIESTKWNNCCRIWISKCNNQT* |
⦗Top⦘ |