NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold CR30jul_10220

Scaffold CR30jul_10220


Overview

Basic Information
Taxon OID3300003625 Open in IMG/M
Scaffold IDCR30jul_10220 Open in IMG/M
Source Dataset NameHypersaline viral communities from Bras del Port, Santa Pola, Spain - CR30 Febrero14 Julio precorrection
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterLifesequencing S.L.
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)746
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → environmental samples → uncultured virus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hypersaline Samples → Hypersaline Viral And Bacterial Communities From Bras Del Port, Santa Pola, Spain

Source Dataset Sampling Location
Location NameBras del Port, Santa Pola, Alicante, Spain
CoordinatesLat. (o)38.192206Long. (o)-0.591865Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F065465Metagenome127N

Sequences

Protein IDFamilyRBSSequence
CR30jul_102201F065465AGGAMSDTITVVCECDAKDEAHSMGYRRYADMPAADIVAAWPVHYTEHGSWDRHIEPTLRCLAGYDDAGYGTYQQRQEIALIRDGDESDHPTDALLIDSMHLFDEITDAWYNGAHQA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.