NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SLW30_106225

Scaffold SLW30_106225


Overview

Basic Information
Taxon OID3300003650 Open in IMG/M
Scaffold IDSLW30_106225 Open in IMG/M
Source Dataset NameSubglacial freshwater microbial communities from Lake Whillans, Antarctica - 3.0 micron filter
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1019
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Subglacial Freshwater → Subglacial Freshwater Microbial Communities From Lake Whillans, Antarctica

Source Dataset Sampling Location
Location NameWest Antarctica
CoordinatesLat. (o)-84.24Long. (o)-153.694Alt. (m)Depth (m)800
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000450Metagenome / Metatranscriptome1126Y
F001043Metagenome / Metatranscriptome794Y
F045058Metagenome / Metatranscriptome153Y

Sequences

Protein IDFamilyRBSSequence
SLW30_1062251F045058N/ALLTFNIGTGSIEKVSNLRDKHNLTEIYVSEYETTGYTGR*
SLW30_1062252F001043GGAGMSDYKEGFDDGVKFAREEMIDKLREININDIDSWLLDRLADMIEGGKL*
SLW30_1062254F000450GAGMGDRANFAFVQENGHSIVLYGHWAGDRMLGRLADAVIKARPRWSDESYATRIAISALVAEQWAEETGWGLQVNSISDNEHKIAVVDFNQLTFSLHEQDEFSNTDNKIRGMKNEAIFTMDLAHFCEKYALEEVLVN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.