NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0040881_115295

Scaffold Ga0040881_115295


Overview

Basic Information
Taxon OID3300003719 Open in IMG/M
Scaffold IDGa0040881_115295 Open in IMG/M
Source Dataset NameFerric microbial mat communities from Yellowstone National Park, Wyoming, USA - One Hundred Spring Plain (OSP_B) (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1384
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.376Long. (o)-110.69Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011097Metagenome / Metatranscriptome295Y
F030159Metagenome / Metatranscriptome186Y

Sequences

Protein IDFamilyRBSSequence
Ga0040881_1152951F030159N/AYIIPITLPPRPDWGGISSMRMKVLYVAPIFHQFQGYGGLSFAWTRDSVEIPFYPEMGTCRPYLTTLPDGKLKVTMGGYHSDNYIDGVAIYLDKSVISPKGKTLVTSPSLIFGQTSPGGSYYVISESPSSTNIIYQGVVTYTFGKKYARVYLNLNANNWGFVNIYTRYRSRSAPDLQQMYGQTPNPNNTSAYYPVVERNFGSLVYLSDYAYGMPFALEYPRTSRFRVDDQVLWVITTNSTSPVWVELEGD*
Ga0040881_1152952F011097GGAGGMLRDVVLYTSGGTDPFTSLTTGGSPITGNSSNYQFLRFHPNYARLHIYITGLSGTSPSIQFTVGTVAGSNNYTLPPITSPIYIYVIGNENRTIITYLNTSSQVLQQVELPYNVFLNGVSVSWSVAGTSPSITAYIHFEFEDEEEGEE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.