NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0040881_122158

Scaffold Ga0040881_122158


Overview

Basic Information
Taxon OID3300003719 Open in IMG/M
Scaffold IDGa0040881_122158 Open in IMG/M
Source Dataset NameFerric microbial mat communities from Yellowstone National Park, Wyoming, USA - One Hundred Spring Plain (OSP_B) (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)922
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.376Long. (o)-110.69Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F083455Metagenome / Metatranscriptome113Y

Sequences

Protein IDFamilyRBSSequence
Ga0040881_1221582F083455N/AMHVDLFSYRLGISSLLAKDVIIALLGTALAVSLTLANKKGESLLIQSTMMMPVAFAIHALPHINYISLNTIFDDGIIATGISLVLDYITTKAERPDLKYRFINMYILLTLYAIIKYPSDVLEFALNSVLMTIAFALITYIPPVDDIL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.