Scaffold Ga0063282_1000327

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0063282_1000327

Scaffold Ga0063282_1000327

Overview

Basic Information
Taxon OID	3300003878 Open in IMG/M
Scaffold ID	Ga0063282_1000327 Open in IMG/M
Source Dataset Name	Plastic marine debris microbial communities from the Atlantic Ocean - SEA_0142_20120611_metagen
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Marine Biological Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	532
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Plastic Marine Debris Microbial Communities From The Atlantic Ocean

Source Dataset Sampling Location
Location Name	Atlantic Ocean
Coordinates	Lat. (^o)	39.978	Long. (^o)	-68.882	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077438	Metagenome / Metatranscriptome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0063282_10003271	F077438	N/A	CCVYSTHRVERPFAQSRFETLFLWKLQVEISSDLMPTVEKEISSNKN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.