NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F077438

Metagenome / Metatranscriptome Family F077438

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077438
Family Type Metagenome / Metatranscriptome
Number of Sequences 117
Average Sequence Length 42 residues
Representative Sequence THRVELSFTQSRFETLFLWNLQVEISSALRPKAEKEISSYKN
Number of Associated Samples 111
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 94.87 %
% of genes from short scaffolds (< 2000 bps) 94.87 %
Associated GOLD sequencing projects 108
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (65.812 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(18.103 % of family members)
Environment Ontology (ENVO) Unclassified
(37.607 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(36.752 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 57.14%    β-sheet: 0.00%    Coil/Unstructured: 42.86%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms65.81 %
UnclassifiedrootN/A34.19 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000519|RepKanNP_Acetate_BrdU_F21BDRAFT_1004337All Organisms → cellular organisms → Bacteria1250Open in IMG/M
3300000519|RepKanNP_Acetate_BrdU_F21BDRAFT_1005741All Organisms → cellular organisms → Bacteria1010Open in IMG/M
3300001114|JGI11758J13082_107410All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300001197|Draft_1001839All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Sanguibacteroides → Sanguibacteroides justesenii1717Open in IMG/M
3300001286|JGI12103J14257_105705All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300001419|JGI11705J14877_10201024Not Available511Open in IMG/M
3300001939|GOS2225_1002050All Organisms → cellular organisms → Bacteria1810Open in IMG/M
3300001964|GOS2234_1016458All Organisms → cellular organisms → Bacteria2917Open in IMG/M
3300002149|C687J26657_10131611Not Available514Open in IMG/M
3300002149|C687J26657_10137627Not Available502Open in IMG/M
3300002231|KVRMV2_100356493All Organisms → cellular organisms → Bacteria2069Open in IMG/M
3300002242|KVWGV2_10248706All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria981Open in IMG/M
3300002512|D0C9_10112099All Organisms → cellular organisms → Bacteria1121Open in IMG/M
3300002898|draft_10413813Not Available627Open in IMG/M
3300003365|JGIcombinedJ50216_1005087All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas syringae group genomosp. 1 → Pseudomonas syringae1868Open in IMG/M
3300003878|Ga0063282_1000327Not Available532Open in IMG/M
3300005057|Ga0068511_1026372All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300005069|Ga0071350_1364444All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300005289|Ga0065704_10216560All Organisms → cellular organisms → Bacteria1089Open in IMG/M
3300005379|Ga0074271_108817Not Available974Open in IMG/M
3300005380|Ga0074272_129010All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli1558Open in IMG/M
3300005767|Ga0078197_123226Not Available524Open in IMG/M
3300005771|Ga0078381_146931All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300005772|Ga0078402_136822All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300006226|Ga0099364_10775101Not Available914Open in IMG/M
3300006917|Ga0075472_10414752Not Available667Open in IMG/M
3300006999|Ga0102676_102167Not Available1458Open in IMG/M
3300006999|Ga0102676_106313All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300006999|Ga0102676_109995All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300007643|Ga0104854_10564938All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300007902|Ga0114311_10169All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300009103|Ga0117901_1182468All Organisms → cellular organisms → Bacteria1141Open in IMG/M
3300009398|Ga0115921_1137225Not Available620Open in IMG/M
3300009613|Ga0105228_114967All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300009622|Ga0105173_1112561Not Available507Open in IMG/M
3300009857|Ga0132190_101662All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300010409|Ga0136855_166751All Organisms → cellular organisms → Bacteria1172Open in IMG/M
3300010933|Ga0137936_1001750All Organisms → cellular organisms → Bacteria2148Open in IMG/M
3300011261|Ga0151661_1004613All Organisms → cellular organisms → Bacteria1368Open in IMG/M
3300012264|Ga0136715_1027213Not Available673Open in IMG/M
3300013023|Ga0157366_1026129Not Available1564Open in IMG/M
3300013286|Ga0136641_1122395Not Available714Open in IMG/M
3300013295|Ga0170791_13683835Not Available897Open in IMG/M
3300013372|Ga0177922_11236287All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300013414|Ga0177923_1143917All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300014597|Ga0169859_107215All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300014717|Ga0134334_12218All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300014857|Ga0134330_11095Not Available823Open in IMG/M
3300017700|Ga0181339_1005188Not Available1661Open in IMG/M
3300017706|Ga0181377_1076781Not Available600Open in IMG/M
3300017724|Ga0181388_1127360All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300017730|Ga0181417_1105773All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300017739|Ga0181433_1125501All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300017764|Ga0181385_1010633Not Available2966Open in IMG/M
3300017779|Ga0181395_1124488All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300017819|Ga0187713_103312All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300018416|Ga0181553_10388965All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300018527|Ga0193021_1002018All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300018608|Ga0193415_1017383Not Available609Open in IMG/M
3300018624|Ga0193577_107995All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300018729|Ga0193174_1071586All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300018799|Ga0193397_10001017All Organisms → cellular organisms → Bacteria1329Open in IMG/M
3300018799|Ga0193397_10011431Not Available571Open in IMG/M
3300018855|Ga0193475_1019349All Organisms → cellular organisms → Bacteria1077Open in IMG/M
3300018913|Ga0192868_10061724All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300018953|Ga0193567_10083103All Organisms → cellular organisms → Bacteria1067Open in IMG/M
3300019016|Ga0193094_10035272Not Available1730Open in IMG/M
3300019022|Ga0192951_10018339All Organisms → cellular organisms → Bacteria1531Open in IMG/M
3300019026|Ga0193565_10049562All Organisms → cellular organisms → Bacteria1452Open in IMG/M
3300019030|Ga0192905_10180900All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300019040|Ga0192857_10034818All Organisms → cellular organisms → Bacteria1077Open in IMG/M
3300019127|Ga0193202_1078237Not Available627Open in IMG/M
3300019136|Ga0193112_1148207Not Available522Open in IMG/M
3300019273|Ga0187794_1152299All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300020181|Ga0196958_10416483Not Available512Open in IMG/M
3300020221|Ga0194127_10183021All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Sanguibacteroides → Sanguibacteroides justesenii1480Open in IMG/M
3300020349|Ga0211511_1047444All Organisms → cellular organisms → Bacteria1076Open in IMG/M
3300020603|Ga0194126_10266061All Organisms → cellular organisms → Bacteria1168Open in IMG/M
3300021066|Ga0196980_1066151Not Available616Open in IMG/M
3300021131|Ga0214206_1013176All Organisms → cellular organisms → Bacteria1121Open in IMG/M
(restricted) 3300023114|Ga0233405_10024998Not Available860Open in IMG/M
3300023205|Ga0255814_11241112All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300023258|Ga0224535_1039912Not Available1094Open in IMG/M
3300025021|Ga0210017_1092871All Organisms → cellular organisms → Bacteria1219Open in IMG/M
3300025022|Ga0210056_1102396Not Available1136Open in IMG/M
3300025075|Ga0209615_101492Not Available1595Open in IMG/M
3300025159|Ga0209619_10544811Not Available567Open in IMG/M
3300025170|Ga0209413_1008235All Organisms → cellular organisms → Bacteria1108Open in IMG/M
3300025177|Ga0208208_110320All Organisms → cellular organisms → Bacteria946Open in IMG/M
3300025181|Ga0207915_104401All Organisms → cellular organisms → Bacteria1121Open in IMG/M
3300025199|Ga0208331_105715All Organisms → cellular organisms → Bacteria1693Open in IMG/M
3300025289|Ga0209002_10607847All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300025319|Ga0209520_10316785All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300025828|Ga0208547_1149124All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300025875|Ga0210040_10345517All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300026104|Ga0208452_1012028All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300026223|Ga0209840_1038132All Organisms → cellular organisms → Bacteria1089Open in IMG/M
3300026231|Ga0209546_1003080All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300026232|Ga0209545_103661All Organisms → cellular organisms → Bacteria1229Open in IMG/M
3300026241|Ga0209032_101183All Organisms → cellular organisms → Bacteria1010Open in IMG/M
3300026682|Ga0208431_103201Not Available508Open in IMG/M
3300026796|Ga0208943_100886All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300027252|Ga0209973_1009340All Organisms → cellular organisms → Bacteria1139Open in IMG/M
3300027414|Ga0208493_10409Not Available562Open in IMG/M
3300027415|Ga0207953_10249All Organisms → cellular organisms → Bacteria1121Open in IMG/M
3300027686|Ga0209071_1054746All Organisms → cellular organisms → Bacteria1207Open in IMG/M
3300027686|Ga0209071_1218462Not Available529Open in IMG/M
(restricted) 3300027730|Ga0247833_1224343Not Available684Open in IMG/M
3300027771|Ga0209279_10035867All Organisms → cellular organisms → Bacteria1439Open in IMG/M
3300027866|Ga0209813_10116174All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300028008|Ga0228674_1128125Not Available863Open in IMG/M
3300030605|Ga0210265_1073851Not Available660Open in IMG/M
3300031646|Ga0302133_10114005All Organisms → cellular organisms → Bacteria1395Open in IMG/M
3300032093|Ga0315902_11155173All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300032159|Ga0268251_10584310All Organisms → cellular organisms → Bacteria511Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine18.10%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater4.31%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean3.45%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.59%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater2.59%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine2.59%
Marine OceanicEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic2.59%
Hypersaline WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Hypersaline Water2.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.59%
Upper TroposphereEnvironmental → Air → Outdoor Air → Unclassified → Unclassified → Upper Troposphere2.59%
Lung MicrobiomeHost-Associated → Human → Respiratory System → Lung → Unclassified → Lung Microbiome2.59%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.72%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater1.72%
Polar DesertEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert1.72%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous1.72%
Subsurface PlumeEnvironmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Subsurface Plume1.72%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment1.72%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.72%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil1.72%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil1.72%
Human Bile DuctHost-Associated → Human → Excretory System → Liver → Bile → Human Bile Duct1.72%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.86%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.86%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.86%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.86%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.86%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.86%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.86%
Meromictic PondEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond0.86%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.86%
Marine WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water0.86%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.86%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.86%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.86%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.86%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.86%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.86%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment0.86%
Marine SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment0.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.86%
RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Rhizosphere0.86%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.86%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.86%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.86%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.86%
Hydrocarbon Resource EnvironmentsEnvironmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Hydrocarbon Resource Environments0.86%
Human Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated0.86%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.86%
HumanHost-Associated → Human → Respiratory System → Nasopharyngeal → Anterior Nares → Human0.86%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.86%
Rat CecumHost-Associated → Mammals → Digestive System → Large Intestine → Cecum → Rat Cecum0.86%
Marine Brown Algae (Kelp) AssociatedHost-Associated → Algae → Brown Algae → Unclassified → Unclassified → Marine Brown Algae (Kelp) Associated0.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.86%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.86%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.86%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave0.86%
Pimephales Promelas GutHost-Associated → Fish → Digestive System → Intestine → Unclassified → Pimephales Promelas Gut0.86%
Fungus GardenHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Fungus Garden0.86%
Food WasteEngineered → Solid Waste → Landfill → Unclassified → Unclassified → Food Waste0.86%
Clean RoomEngineered → Unclassified → Unclassified → Unclassified → Unclassified → Clean Room0.86%
Biogas FermenterEngineered → Unclassified → Unclassified → Unclassified → Unclassified → Biogas Fermenter0.86%
Swimming Pool Sandfilter BackwashEngineered → Built Environment → Unclassified → Unclassified → Unclassified → Swimming Pool Sandfilter Backwash0.86%
Biofilm Marine Aquaculture PlantEngineered → Built Environment → Unclassified → Unclassified → Unclassified → Biofilm Marine Aquaculture Plant0.86%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000519Amended soil microbial communities from Kansas Great Prairies, USA - acetate and BrdU F2.1BEnvironmentalOpen in IMG/M
3300001114Marine microbial communities from the Deep Pacific Ocean - MP1648EnvironmentalOpen in IMG/M
3300001197Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Sediment core from a heavy oil reservoir,Alberta Canada Inniskillen 614.3EnvironmentalOpen in IMG/M
3300001286Groundwater microbial communities from S. Glens Falls, New York, USA - Naphthalene biodegradation metagenome 12C5doseEnvironmentalOpen in IMG/M
3300001419Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m)EnvironmentalOpen in IMG/M
3300001939Marine microbial communities from Block Island, New York, USA - GS009EnvironmentalOpen in IMG/M
3300001964Marine microbial communities from Rosario Bank, Honduras - GS018EnvironmentalOpen in IMG/M
3300002149Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2EnvironmentalOpen in IMG/M
3300002231Marine sediment microbial communities from Santorini caldera mats, Greece - red matEnvironmentalOpen in IMG/M
3300002242Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey matEnvironmentalOpen in IMG/M
3300002512Gut microbiomes of Pimephales promelas (fathead minnow) during Triclosan exposure experiment - D0C9- baselineHost-AssociatedOpen in IMG/M
3300002898Metagenome Biopara biogasfermenter May 2013 pooledEngineeredOpen in IMG/M
3300002974Subsurface hydrocarbon microbial communities from various worldwide Shell locationsEnvironmentalOpen in IMG/M
3300003365Combined assembly of clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - Phoenix at KSC-PHSF (ASSEMBLY_DATE=20140826)EngineeredOpen in IMG/M
3300003878Plastic marine debris microbial communities from the Atlantic Ocean - SEA_0142_20120611_metagenEnvironmentalOpen in IMG/M
3300005057Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2umEnvironmentalOpen in IMG/M
3300005069Metagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005379Marine microbial communities from Deepwater Horizon subsurface plume in Gulf of Mexico, 16-4 Below PlumeEnvironmentalOpen in IMG/M
3300005380Marine microbial communities from Deepwater Horizon subsurface plume in Gulf of Mexico, 16-5 In PlumeEnvironmentalOpen in IMG/M
3300005767Human lung microbial communities from HIV infected subject HIV3-1Host-AssociatedOpen in IMG/M
3300005771Human lung microbial communities from HIV infected subject HIV091228-1Host-AssociatedOpen in IMG/M
3300005772Human lung microbial communities from Normal Smokers Background 100804-1Host-AssociatedOpen in IMG/M
3300006226Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P3Host-AssociatedOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006999Non-marine hypersaline water viral communities from A?ana, Logroño, Spain -Vir_A?ana_2_PREEnvironmentalOpen in IMG/M
3300007643Biofilm microbial communities from a marine aquaculture plant in North Sea, GermanyEngineeredOpen in IMG/M
3300007902Human anterior nares microbial communities from NIH, USA - visit 1, subject 159753524 replicate 1 reassemblyHost-AssociatedOpen in IMG/M
3300009103Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 250-2.7umEnvironmentalOpen in IMG/M
3300009398Microbial communities from sand-filter backwash in Singapore swimming pools - JW-2EngineeredOpen in IMG/M
3300009613Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3737_250EnvironmentalOpen in IMG/M
3300009622Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155EnvironmentalOpen in IMG/M
3300009857Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 4, 6m depth; RNA IDBA-UDEnvironmentalOpen in IMG/M
3300010409Giant kelp blades associated microbial communities from the kelp forest near Monterey Bay Aquarium, California, USA ? sample BHost-AssociatedOpen in IMG/M
3300010933Marine sediment microbial communities from North Pond, Atlantic Mid-Ocean Ridge - NP_1383EEnvironmentalOpen in IMG/M
3300011261Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, 0.02EnvironmentalOpen in IMG/M
3300012264Freshwater sediment bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - Sed-PBS metaGEnvironmentalOpen in IMG/M
3300013023Fungus gardens microbial communities from leaf cutter ant in Botucatu, State of S?o Paulo, Brazil - Atta bisphaerica ABBM1Host-AssociatedOpen in IMG/M
3300013286Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23YEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300013414Rat cecal microbial community from a salt sensitive rat, Toledo, Ohio, USA - rat 1Host-AssociatedOpen in IMG/M
3300014597Human fecal microbial communities from newborn in Denmark - 635_BHost-AssociatedOpen in IMG/M
3300014717Human bile duct microbial communities from gallstone patients in Hangzhou, China - C4_bileHost-AssociatedOpen in IMG/M
3300014857Human bile duct microbial communities from gallstone patients in Hangzhou, China - B6_bileHost-AssociatedOpen in IMG/M
3300017700Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.DEnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017819Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in ATCC 1651 MA medium w/o phosphatidylcholine, 4 C, 30 psu salinity and 140 ?mol photons light - Anophryoides haemophila AH6 (MMETSP1019) (SRX566756-SRR1328076)Host-AssociatedOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018527Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_144 - TARA_N000003179 (ERX1782218-ERR1712041)EnvironmentalOpen in IMG/M
3300018608Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002024 (ERX1782181-ERR1712102)EnvironmentalOpen in IMG/M
3300018624Metatranscriptome of marine microbial communities from deep sea water colum in Eastern Mediterranean Sea - KM3-5EnvironmentalOpen in IMG/M
3300018729Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000313 (ERX1789694-ERR1719374)EnvironmentalOpen in IMG/M
3300018799Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002039 (ERX1782418-ERR1711999)EnvironmentalOpen in IMG/M
3300018855Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002191 (ERX1782341-ERR1711903)EnvironmentalOpen in IMG/M
3300018913Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782451-ERR1712205)EnvironmentalOpen in IMG/M
3300018953Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002753EnvironmentalOpen in IMG/M
3300019016Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000045 (ERX1789509-ERR1719322)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019026Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_150 - TARA_N000002719EnvironmentalOpen in IMG/M
3300019030Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000666 (ERX1789399-ERR1719153)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019040Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782167-ERR1712154)EnvironmentalOpen in IMG/M
3300019127Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000014 (ERX1782135-ERR1712133)EnvironmentalOpen in IMG/M
3300019136Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000325 (ERX1782382-ERR1712004)EnvironmentalOpen in IMG/M
3300019273Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020181Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_10EnvironmentalOpen in IMG/M
3300020221Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100mEnvironmentalOpen in IMG/M
3300020349Marine microbial communities from Tara Oceans - TARA_E500000081 (ERX289006-ERR315859)EnvironmentalOpen in IMG/M
3300020603Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150mEnvironmentalOpen in IMG/M
3300021066Soil microbial communities from Anza Borrego desert, Southern California, United States - S3_10-13CEnvironmentalOpen in IMG/M
3300021131Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnionEnvironmentalOpen in IMG/M
3300023114 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_3_MGEnvironmentalOpen in IMG/M
3300023205Combined Assembly of Gp0242100, Gp0242119EngineeredOpen in IMG/M
3300023258Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 30-34EnvironmentalOpen in IMG/M
3300025021Groundwater microbial communities from aquifer - Crystal Geyser CG08_land_8/20/14_0.20 (SPAdes)EnvironmentalOpen in IMG/M
3300025022Groundwater microbial communities from aquifer - Crystal Geyser CG07_land_8/20/14_0.80 (SPAdes)EnvironmentalOpen in IMG/M
3300025075Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025159Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3EnvironmentalOpen in IMG/M
3300025170Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - JTO22cm metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025177Marine microbial communities from the Deep Indian Ocean - MP1091 (SPAdes)EnvironmentalOpen in IMG/M
3300025181Marine microbial communities from the Deep Indian Ocean - MP1241 (SPAdes)EnvironmentalOpen in IMG/M
3300025199Marine microbial communities from the Deep Pacific Ocean - MP1648 (SPAdes)EnvironmentalOpen in IMG/M
3300025289Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2EnvironmentalOpen in IMG/M
3300025319Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1EnvironmentalOpen in IMG/M
3300025828Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025875Groundwater microbial communities from aquifer - Crystal Geyser CG19_WC_8/21/14_NA (SPAdes)EnvironmentalOpen in IMG/M
3300026104Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3611_800 (SPAdes)EnvironmentalOpen in IMG/M
3300026223Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes)EnvironmentalOpen in IMG/M
3300026231Upper troposphere microbial communities from California, USA - DAQCA-005 (SPAdes)EnvironmentalOpen in IMG/M
3300026232Upper troposphere microbial communities from Maryland, USA - DAQMD-018 (SPAdes)EnvironmentalOpen in IMG/M
3300026241Upper troposphere microbial communities - SDPR-003 (SPAdes)EnvironmentalOpen in IMG/M
3300026682Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series 2014_1_29 (SPAdes)EnvironmentalOpen in IMG/M
3300026796Rhizosphere microbial communities from Harvard Forest, USA - 6Rhizosphere_unsorted metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027252Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027414Polar desert microbial communities from Antarctic Dry Valleys - UQ493 (SPAdes)EnvironmentalOpen in IMG/M
3300027415Polar desert microbial communities from Antarctic Dry Valleys - UQ313 (SPAdes)EnvironmentalOpen in IMG/M
3300027686Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027730 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8mEnvironmentalOpen in IMG/M
3300027771Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027866Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)Host-AssociatedOpen in IMG/M
3300028008Seawater microbial communities from Monterey Bay, California, United States - 1D_rEnvironmentalOpen in IMG/M
3300030605Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE042SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031646Marine microbial communities from Western Arctic Ocean, Canada - CB9_33.1EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032159Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
RepKanNP_Acetate_BrdU_F21BDRAFT_100433713300000519SoilHRVERSFTQSRFETLFFWNLQVEISAALRSMVEKEISSYKN*
RepKanNP_Acetate_BrdU_F21BDRAFT_100574113300000519SoilVYSTHTVERWFTQSRFETLFLWNLQVEISAALRSMVE
JGI11758J13082_10741013300001114Deep OceanVYSSHRVEPSFRQSSFEKFFLWSLQVEISSDLRLIFEMEISSCKNYTE
Draft_100183943300001197Hydrocarbon Resource EnvironmentsSTHRVEPSFIQSSFEKHFLWNLQVEISSDLTPILDMEISSY*
JGI12103J14257_10570513300001286GroundwaterEEFSVTSLCCVYSTHRVERSFTQSRLETLFLWNLQVEISAALRSMVE*
JGI11705J14877_1020102413300001419Saline Water And SedimentYTEEFSVIYLWCVYSTHRVEPSFRKSRFETLFLWSFHVEISIALRPKVEKETSSYKN*
GOS2225_100205013300001939MarineLLEEEFSVTSLCCVYSTHRVERSFTQSRLETLFLWNLQVEISAALSSMVE*
GOS2234_101645833300001964MarineVYSTDRVELSFRESRFETLFLWNLQVEISSALGPKAVKEISSYKN*
C687J26657_1013161113300002149SoilHRVERSFTQSRLETLFLWNLQVEISSALRPKAEKEISSYKN*
C687J26657_1013762723300002149SoilLSFRESRFETLFLWNLQVEISSALGPKAEKEISSYKN*
KVRMV2_10035649313300002231Marine SedimentLETGFLHILLEEEFSVTSLCCVYSTHRVEGSFTESRLETLFLWNLQVEISAALRSMVE*
KVWGV2_1024870613300002242Marine SedimentVYSTHRVEPFFRESRVETLCFWNLQVQISSASRPMAEKELS
D0C9_1011209923300002512Pimephales Promelas GutEEFSVTSLCCVYSTHRVERPFAQSRFETLFLWNLQVEISSDLMPTVEKEISSNKN*
draft_1041381313300002898Biogas FermenterVYSTDRVELSFGESRFETLFLWNLQVEISSALRPKAEKEISSYKN*
GW671_10108513300002974VEPSFRQSRFESLFLWNLQVEISSALRPKAEKEISSYKN*
JGIcombinedJ50216_100508763300003365Clean RoomVELSFRESRFETLFLWNLQVEISSALGPKAEKEISSYKN*
Ga0063282_100032713300003878MarineCCVYSTHRVERPFAQSRFETLFLWKLQVEISSDLMPTVEKEISSNKN*
Ga0068511_102637223300005057Marine WaterVYSTHRVEPSFIQSSFETLFLWNLQVEISSDLTPILDTEISSY*
Ga0071350_136444413300005069FreshwaterVYSTHRVEPFFRESRVETLCFWNLQVQISSASRPMAEKEISSYKN
Ga0065704_1021656013300005289Switchgrass RhizosphereVYSTHRVEPSFIQSSFEKHFLWNLQVEISSDLTPILDMEISS
Ga0074271_10881733300005379Subsurface PlumeTHRVERPFAQSRFETLFLWSLQVEISSDLMPTVEKEISSNKN*
Ga0074272_12901013300005380Subsurface PlumeVTSLWCVYSTHRVEPSFRQSRFETPYLCSFQLEISIALRPNVEKETSSYKN*
Ga0078197_12322613300005767Lung MicrobiomeDEPSFRKSRFETLFLWSFHVEISIALRPKVEKETSSYKN*
Ga0078381_14693113300005771Lung MicrobiomeSTDRVEPSFRQSRFETLFLWNLQVEISDALRSMVEKDISSYKNLTE*
Ga0078402_13682213300005772Lung MicrobiomeMECPITQSSFETLFLWNLKVENSSDLMPTVEKEISSNKN*
Ga0099364_1077510133300006226Termite GutHRVELSFTQSRFETLFLWNLQVEISSALRPKAEKEISSYKN*
Ga0075472_1041475213300006917AqueousTEEFSVTYLWCVYSTHRVEPSFRKSRFETLFLWSFHVEISIALRPKVEKETSSYKN*
Ga0102676_10216713300006999Hypersaline WaterRKSRFETLFLWSFHVEISIALRPKVEKETSSYNN*
Ga0102676_10631313300006999Hypersaline WaterFEPFFRESRVETLFLWNLLVQISNSSKTVIEKDISSY*
Ga0102676_10999513300006999Hypersaline WaterSTHRVERSFTQSRLETLFLWNLQVEISAALRSIVEKEISS*
Ga0104854_1056493813300007643Biofilm Marine Aquaculture PlantSLCCVYSTHRVERPFAQSRFETLFLWSLQVEISSDLMPTVEKEISSNKN*
Ga0114311_1016913300007902HumanSTHRVEPFFTESRFETFFPWNLLVQISNASRTMAEKVISSY*
Ga0117901_118246833300009103MarineVERPFAQSRFETLFLWSLQVEISSDLMPTVEKEISSNKN*
Ga0115921_113722523300009398Swimming Pool Sandfilter BackwashVYSTERVELSFRESRFETLFLWNLQVEISSALGPKAEKEISSYKN*
Ga0105228_11496713300009613Marine OceanicVEPSFIQSSFEKHFLWNLQVEISSDLTPILDMEISSY*
Ga0105173_111256113300009622Marine OceanicFLQSRFETLFLWYLQVEISAALMSMIEKEISSYKN*
Ga0132190_10166213300009857Meromictic PondVERPFAQSRFETFFLSNLQVEISSDLMPTVEKEISSN
Ga0136855_16675123300010409Marine Brown Algae (Kelp) AssociatedSTHRVERPFAQSRFETLFLWSLQVEISSDLMPTVEKEISSNKN*
Ga0137936_100175013300010933Marine SedimentTKSRFETLFLWNLQVEISSALRPKAEKEISSYKN*
Ga0151661_100461323300011261MarinePYVMLCRFETLFLWNFQVEISTALRTMVEKEISSYKN*
Ga0136715_102721313300012264Freshwater SedimentPSFIQSSFETLFLWNLQVEISDALRSMVEKDISSYKNLTE*
Ga0157366_102612913300013023Fungus GardenVEPSFRKSRFETLFLWSFHVEISIALRPKVEKETSSYKN*
Ga0136641_112239523300013286FreshwaterSFTQSRFETLFLWNLQVEISSALGPKAEKEISSYKN*
Ga0170791_1368383513300013295FreshwaterEPSFRKSRFETLFLWSFHVEISIALRPKVEKETSSYKN*
Ga0177922_1123628713300013372FreshwaterFTQSRLETLFLWNLQVEISSALRPKAEKEISSYKN*
Ga0177923_114391713300013414Rat CecumSLCCVYSTHRVERPFAQRRFETLFLWSLKVEISSDLMPTVEKEISSNKN*
Ga0169859_10721513300014597Human Host-AssociatedTHRVELSFTQSRFETLFLCNWQVEISSALRSMAEKEISSFQN*
Ga0134334_1221813300014717Human Bile DuctTHRDELSFRQSRFETLFSWNLQVEISLALRTMVEKEISSYKN*
Ga0134330_1109513300014857Human Bile DuctTHRVEPSFIQSSFETLFLWNFQVEISRDLTPILDMEISSY*
Ga0181339_100518813300017700Freshwater LakeRDEPSFRKSRFETLFLWSFHVEISIALRPKVEKETSSYNN
Ga0181377_107678113300017706MarineEPSFRKSRFETLFLWSFHVEISIALRPKVEKETSSYNN
Ga0181388_112736013300017724SeawaterVYSTHRDEPSFRKSRFETLFLWSFHVEISIALRPKVEKE
Ga0181417_110577313300017730SeawaterVEVSFIQSSFETLFLWNLQVEISSDFTPILDMEISSY
Ga0181433_112550123300017739SeawaterTEEFPVTSLCCVCSTHRVELSFTQSRLETLFLWNLQVEISSALRPKAEKEIFSYKN
Ga0181385_101063313300017764SeawaterSTHRVEPSFRESRVETLCFWNLQVQISSDSRPMAEKEISSYKN
Ga0181395_112448813300017779SeawaterVYSSQRVEPSFRQSSFEKFFLWDLQVEISSDLRLIFEMEI
Ga0187713_10331213300017819Host-AssociatedSEDFSVTSLGCVYATHRVQPSFRQSRFETLFLWNLQVEISSALRPKAEKEISSYKN
Ga0181553_1038896513300018416Salt MarshVYSTDRVEPSFRQSRFESLFLWNLQVEISSALRPKAEKEIFSYKN
Ga0193021_100201813300018527MarineSVTSLCCVYSTHRVERPFAQSRFETLFLWNLQVEISSDLMPTVEKEISSNKN
Ga0193415_101738313300018608MarineCVYSTHRVERPFAQSRFETLFLWSLQVEISSDLMPTVEKEISSNKN
Ga0193577_10799513300018624MarineVERPFTQSRFETLFLWNLQVEISSDLMPTVEKEIS
Ga0193174_107158613300018729MarineRVERPFAQSRFETLFLWRLQVEISSDLMPTVEKEISSNKN
Ga0193397_1000101723300018799MarinePFAQSRFETLFLWSLQVEISSDLMPTVEKEISSNKN
Ga0193397_1001143113300018799MarineSLCCVYSTDRVELSFRESRFETLFLWNLQVEISSALGPKAEKEISSYKN
Ga0193475_101934913300018855MarineVERPFAQSRFETLFLWSLQVEISSDLMPTVEKEIS
Ga0192868_1006172423300018913MarineTSLCCVYSTDRVELSFRESRFETLFLWNLQVEISSALRPKAEKEISSYKN
Ga0193567_1008310313300018953MarineVERPFTQSRFETLFLWSLQVEISSDLMPTVENEISSN
Ga0193094_1003527213300019016MarineTEEFSVTYLWCVYSTHRDEPSFRKSRFETLFLWSFHVEISIALRPKVEKETSSYKN
Ga0192951_1001833933300019022MarineVTSLCCVYSSDRVELSFRESRFETLFLWNLQVEISSALGPKAEKEISSYKN
Ga0193565_1004956223300019026MarineFRESRFETLFLWNLQVEISSALGTKAEKEISSYKN
Ga0192905_1018090013300019030MarineVTSLCCVYSTHRVERPFAQSRFETLFLWSLQVEISSDLMPTVEKEISSNKN
Ga0192869_1011087513300019032MarineTHRVERPFRQSRFETLFLRNLQVEISSHLMPTVEREISSNKNQTESFSENSL
Ga0192857_1003481823300019040MarineFTQSRFETLFLWNLQVEISSDLMPTVEKEISSNKN
Ga0193202_107823713300019127MarineEEFSVTSLCCVYSTHRVERPFAQSRFETLFLWSLQVEISSDLKPTVEKEISSNKN
Ga0193112_114820713300019136MarineFTQSRFETLFLWSLQVEISSDLMPTVEKEISSNKN
Ga0187794_115229913300019273PeatlandTHRDEPSFRKSRFETLFLWSFHVEISIALRPKVEKETSSYKN
Ga0196958_1041648323300020181SoilTHRVERPFAQSRFETLFLWNLQVEISSDLMPTVEKEISSNKN
Ga0194127_1018302113300020221Freshwater LakeFTQSRLETLFLWNLQVEISAALRSMVEKEISSYKN
Ga0211511_104744413300020349MarineTSLCCVYSTHRVERPFAQSRFETLFLWSLQVEISSDLMPTVEKEISSNKN
Ga0194126_1026606123300020603Freshwater LakeRPFAQSRFETLFLWSLQVEISSDLMPTVEKEISSNKN
Ga0196980_106615113300021066SoilFRKSRFETLFLWSFHVEISIALRPKVEKETSSYKN
Ga0214206_101317633300021131FreshwaterVERPFAQSRFETLFLWSLQVEISSDLMPTVEKEISSNK
(restricted) Ga0233405_1002499813300023114SeawaterTHRDEPSFRKSRFETLFLWSFHVEISIALRPKVEEETSSYNN
Ga0255814_1124111213300023205Food WasteTHRVERPFAQSRFETLFLWSLQVEISSDLMPTVEKEISSNKN
Ga0224535_103991213300023258SoilYSTHRDEPSFRKSRFETLFLWSFHVEISIALRPKVEKETSSYNN
Ga0210017_109287123300025021GroundwaterPSFIQSSFEKHFLWNLQVEISSDLTPILDMEISSY
Ga0210056_110239623300025022GroundwaterSTHRDEPSFRKSRFETLFLWSFHVEISIALRPKVEKETSSYKN
Ga0209615_10149213300025075FreshwaterDEPSFRKSRFETLFLWSFHVEISIALRPKIEKETSSYNN
Ga0209619_1054481113300025159SoilTHRVELSFTQSRFETLFLWNLQVEISSALRPKAEKEISSYKN
Ga0209413_100823513300025170FreshwaterSLCCVYSTHRVERPFAQSRFETLFLWSLQVEISSDLMPTVEKEISSNKN
Ga0208208_11032023300025177Deep OceanTHRVERPFRQSRFETLFLWNLQVEISSDLMPTVEKEISSNKN
Ga0207915_10440133300025181Deep OceanVERPFAQSRFETLFLWNLQVEISSDLMPTVEKEISSNK
Ga0208331_10571513300025199Deep OceanFTQSRFETLFLWNLQVEISAALRSMVEKEISSYKN
Ga0209002_1060784723300025289SoilPFAQSRFETLFLWNLQVEISSDLMPTVEKEISSNKN
Ga0209520_1031678513300025319SoilVYSTHRVEPCFRESRFETLLLWHFQVEISSDLRTIAEKEI
Ga0208547_114912413300025828AqueousERPFTQSRFETLFLWSLQVEISSDLMPTVEKEISSNKN
Ga0210040_1034551713300025875GroundwaterCVCSTHRVELSFTQSRFETLFLWNLQMEISSALRPKAEKEISSYKN
Ga0208452_101202813300026104Marine OceanicRVEPSFIQSSFEKHFLWNLQVEISSDLTPILDMEISSY
Ga0209840_103813223300026223SoilVERPFAQSRFETLFLWNLQVEISSDLMPTVEKEISSN
Ga0209546_100308013300026231Upper TroposphereSTHRVERSFTESRLETLFLWNLQVEISAALRSIVEKEISS
Ga0209545_10366113300026232Upper TroposphereSVTSLCCVYSTHRVERSFTQSRLETLFLWNLQVEISAALRSIVEKEISS
Ga0209032_10118323300026241Upper TroposphereERPFTQSRFEKLFLWSLQVEISSDLMPTVEKEISSNKN
Ga0208431_10320113300026682Deep SubsurfaceERVELSFRESRFETLFLWNLQVEISSALGPKAEKEISSYKN
Ga0208943_10088623300026796RhizosphereVYSTHRVEGSFTQSRLETLFLWNLQVEISSALRPKAEKEISSYKK
Ga0209973_100934013300027252Arabidopsis Thaliana RhizosphereFSVTSLCCVYSTHRVERPFAQSRFETLFLWNLQVEISSDLMPTVEKEISSNKN
Ga0208493_1040913300027414Polar DesertYSTHRVERPFAQSRFETLFLWSLQVEISSDLMPTVEKEISSNKN
Ga0207953_1024913300027415Polar DesertEEFSVTSLCCVYSTHRVERPFAQSRFETLFLWSLQVEISSDLMPTVEKEISSNKK
Ga0209071_105474623300027686MarineVERPFAQSRFETLFLWNLQVEISSDLMPTVEKEISANKN
Ga0209071_121846213300027686MarineCSTHRVELSFTQSRFETLFLWNLQMEVSSALRPKAEKEISSYKN
(restricted) Ga0247833_122434313300027730FreshwaterSFRKSRFETLFLWSFHVEISIALRPKVEKETSSYKN
Ga0209279_1003586713300027771MarineFTQSRFETLFFWNLQVEISAALRSMVEKEISSYKN
Ga0209813_1011617413300027866Populus EndosphereRVERPFAQSRFETLFLWNLQVEISSDLMPTVEKEISSNKN
Ga0228674_112812523300028008SeawaterRDETSFRKSRFETLFLWSFHVEISIALRPKVEKETSSYNN
Ga0210265_107385123300030605SoilRGELSFRQSRCETLFLGYLQVEISSAFRPNVEKEISSYKN
Ga0302133_1011400533300031646MarineEPSFRKSRFETLFLWSFHVEISIALRPKVEKETSSYKN
Ga0315902_1115517313300032093FreshwaterSFRQSRCETLFLGYLQVEISSAFRPNVEKEISSYKN
Ga0268251_1058431013300032159AgaveVYSTDRVELSFRESRFETLFLWNLQVEISSALGPKAEKEI

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.