Sample 3300014857

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300014857

3300014857: Human bile duct microbial communities from gallstone patients in Hangzhou, China - B6_bile

Overview

Basic Information
IMG/M Taxon OID	3300014857 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0121295 \| Gp0151502 \| Ga0134330
Sample Name	Human bile duct microbial communities from gallstone patients in Hangzhou, China - B6_bile
Sequencing Status	Permanent Draft
Sequencing Center	Beijing Institution of Radiation Medicine
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	3468581
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Human Bile Duct Microbial Communities From Gallstone Patients In Hangzhou, China
Type	Host-Associated
Taxonomy	Host-Associated → Human → Excretory System → Liver → Bile → Human Bile Duct → Human Bile Duct Microbial Communities From Gallstone Patients In Hangzhou, China

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal proximal gut

Location Information
Location	China: Hangzhou
Coordinates	Lat. (^o)	N/A	Long. (^o)	N/A	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077438	Metagenome / Metatranscriptome	117	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0134330_11095	Not Available	823	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0134330_11095	Ga0134330_110951	F077438	THRVEPSFIQSSFETLFLWNFQVEISRDLTPILDMEISSY*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.