 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300025199 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053074 | Gp0053866 | Ga0208331 |
| Sample Name | Marine microbial communities from the Deep Pacific Ocean - MP1648 (SPAdes) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 69660325 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| Not Available | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine water body → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | North of Tokelau, South Pacific Ocean | |||||||
| Coordinates | Lat. (o) | -5.74 | Long. (o) | -170.77 | Alt. (m) | N/A | Depth (m) | 4017.73 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001487 | Metagenome | 686 | Y |
| F077438 | Metagenome / Metatranscriptome | 117 | Y |
| F084703 | Metagenome / Metatranscriptome | 112 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0208331_105715 | All Organisms → cellular organisms → Bacteria | 1693 | Open in IMG/M |
| Ga0208331_122571 | Not Available | 568 | Open in IMG/M |
| Ga0208331_127165 | Not Available | 500 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0208331_105715 | Ga0208331_1057151 | F077438 | FTQSRFETLFLWNLQVEISAALRSMVEKEISSYKN |
| Ga0208331_122571 | Ga0208331_1225711 | F084703 | EVLPSSHLRGMFSTAVPRFLPDKLEPLGLSLSGQLRVAS |
| Ga0208331_127165 | Ga0208331_1271651 | F001487 | MKKFTIEVSHASPAQLTTIGLELKIMSNGWEKFGLR |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |