x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300009857
3300009857: Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 4, 6m depth; RNA IDBA-UD
Overview
| Basic Information |
| IMG/M Taxon OID | 3300009857 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0116874 | Gp0151141 | Ga0132190 |
| Sample Name | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 4, 6m depth; RNA IDBA-UD |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Marine Biological Laboratory |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 4753154 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 5 |
| Associated Families | 5 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda | 1 |
| All Organisms → cellular organisms → Bacteria | 1 |
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Aquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond → Aquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts |
| Location Information |
| Location | Falmouth, Massachusetts |
| Coordinates | Lat. (o) | 41.548517 | Long. (o) | -70.622961 | Alt. (m) | N/A | Depth (m) | 6 |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F000077 | Metagenome / Metatranscriptome | 2584 | Y |
| F000237 | Metagenome / Metatranscriptome | 1498 | Y |
| F005974 | Metagenome / Metatranscriptome | 384 | Y |
| F077438 | Metagenome / Metatranscriptome | 117 | Y |
| F078755 | Metatranscriptome | 116 | Y |
Associated Scaffolds
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| Ga0132190_101657 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda | 540 | Open in IMG/M |
| Ga0132190_101662 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| Ga0132190_101672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| Ga0132190_100333 | Ga0132190_1003331 | F000237 | TDQLTRLMVLHYFTP*YYLYLVKLHVMFCHES*DSDSGENVYEDKSGTYVS*FYDAFLKEIQDA*Y*TLYVFVYFIIHHFDASTVNYFFFER*NISELDEIRFYGVAPH*YFRPLMGLLVVSPSHYEGLM*MALWFVLLASLPIIYNFYNSSKYYLPIIPMQSSMSQTLCFILFMLSMYCTASMLPCGRYYYAPEGGYVGNP*VKFSYQYAYLYMA*ILHHLDIIEH*GFRYTQNLLRRCSNISKISKKRMQVLSITHMSQYRRNRKAELTFTNSYKLNMA*NSSIKYIKR* |
| Ga0132190_101657 | Ga0132190_1016571 | F078755 | SIRSRNNMQGFLALAVTIAVVAADSGYAPAPEYLCRDTNTSIYAEVCVPAFAEQITPVTLAVKEVVDNDYCFDRVLTVCEETSSFVDREICTYEYAREDVVADCTTTQVTYAEKSETMKVTTCSASGYGTPGYGAGEHQYCREEYQTQAYRVPLVTEPKLESCKLAYPAPSKVCVTKTL |
| Ga0132190_101662 | Ga0132190_1016621 | F077438 | VERPFAQSRFETFFLSNLQVEISSDLMPTVEKEISSN |
| Ga0132190_101672 | Ga0132190_1016721 | F005974 | GNFVRFSLDEFLRGNPLERAQVYEILNRIGAMSVEEIRKEEDLLK* |
| Ga0132190_101986 | Ga0132190_1019861 | F000077 | DAALLTKEIAELDEDITIWKGDIKAATKVREIEKADYDALHKDYSESIDALQRAIAVLKKQAYDRKQASFVQVAALKNLNLIPADAKKAIDLFLMQDPEGLAVSAPEANAYEFQSSGVIEMLEKLLDKFIDERTTLEKEEMNSKHAYDMLMQDLTAQIAQATQDRDEK |
