Scaffold Ga0065726_18341

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0065726_18341

Scaffold Ga0065726_18341

Overview

Basic Information
Taxon OID	3300004369 Open in IMG/M
Scaffold ID	Ga0065726_18341 Open in IMG/M
Source Dataset Name	Saline microbial communities from the South Caspian sea - cas-15
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Beijing Genomics Institute (BGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	10532
Total Scaffold Genes	8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline → Saline Microbial Communities From The South Caspian Sea

Source Dataset Sampling Location
Location Name	Caspian Sea
Coordinates	Lat. (^o)	41.916215	Long. (^o)	50.672019	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016736	Metagenome / Metatranscriptome	245	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0065726_183411	F016736	N/A	LTLLIRGVYLIDQLGPTYKQLQTGVREKEEAETKGESDAKS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.