Scaffold Ga0066223_1064785

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0066223_1064785

Scaffold Ga0066223_1064785

Overview

Basic Information
Taxon OID	3300004461 Open in IMG/M
Scaffold ID	Ga0066223_1064785 Open in IMG/M
Source Dataset Name	Marine viral communities from Newfoundland, Canada BC-2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Yale University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	5223
Total Scaffold Genes	13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (23.08%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Viral Communities From Newfoundland, Canada

Source Dataset Sampling Location
Location Name	Newfoundland, Canada
Coordinates	Lat. (^o)	47.593411	Long. (^o)	-52.885466	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079230	Metagenome	116	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0066223_10647859	F079230	N/A	MIDSLIYGILASSFVIGITRSVLLLYAKFPRLGFGLIYGSLGVKMFAIGAFTLLAKPYIENVAIYAALILAAIIYSNVYVLLKLHGK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.