Basic Information | |
---|---|
Taxon OID | 3300004621 Open in IMG/M |
Scaffold ID | Ga0058866_1321094 Open in IMG/M |
Source Dataset Name | Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - TNR Reactor, Time D- 0min-Aerobic_ RNA (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 501 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Wastewater Treatment → Wastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Madison, Wisconsin, USA | |||||||
Coordinates | Lat. (o) | 43.076217 | Long. (o) | -89.411742 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F045501 | Metagenome / Metatranscriptome | 152 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0058866_13210942 | F045501 | N/A | EFPSNSNDLPSSSTTTNTVSQQQQPTTAPPVFKTEMLDWLQSDFDEFDLGPPPTQLASDRVTRSMKKLNVQEKTKQEDDEQDWVHVE* |
⦗Top⦘ |