Scaffold Ga0071082_103266

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0071082_103266

Scaffold Ga0071082_103266

Overview

Basic Information
Taxon OID	3300005058 Open in IMG/M
Scaffold ID	Ga0071082_103266 Open in IMG/M
Source Dataset Name	Co-DHS sludge microbial communities
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Illinois, Urbana-Champaign
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	22812
Total Scaffold Genes	22 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	9 (40.91%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Down-Flow Hanging Sponge Reactor → Down-Flow Hanging Sponge Reactor Microbial Communities From The University Of Illinois At Urbana-Champaign, Usa

Source Dataset Sampling Location
Location Name	Urbana, Illinois, USA
Coordinates	Lat. (^o)	40.114056	Long. (^o)	-88.226756	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051238	Metagenome	144	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0071082_1032661	F051238	N/A	MITNTLAPGLGSLVALALGGLYHGYRQVRNRKVNEALVQGVETARAILETTPQGQQADAQFVKWLMEHQKETGIFTVVSGLVDQHSDNPAARLTAQEIIERIQKAQG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.