NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0072504_129017

Scaffold Ga0072504_129017


Overview

Basic Information
Taxon OID3300005095 Open in IMG/M
Scaffold IDGa0072504_129017 Open in IMG/M
Source Dataset NameHydrothermal chimney microbial communities from the East Pacific Rise - L vent 8
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBeijing Genomics Institute (BGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)15845
Total Scaffold Genes29 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)27 (93.10%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Hydrothermal Chimney In Epr

Source Dataset Sampling Location
Location NameEast Pacific Rise
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F103293Metagenome101Y

Sequences

Protein IDFamilyRBSSequence
Ga0072504_12901725F103293AGGAGGMIEIEKLPELPPPYEIYEFQPCQPAYFKVVEFKIGRMTIQPRFPGAPPTKTIAAIRLYVDPKTKKFYPPWYDITPSRLVYQLAGMLTQGIPQGMWLRIHRDVPGPKAHFSVSWVQAPP*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.