 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300005107 Open in IMG/M |
| Scaffold ID | Ga0068702_100041 Open in IMG/M |
| Source Dataset Name | Cellulose-adapted microbial communities from the Joint BioEnergy Institute, USA - Passage D2F08 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 100213 |
| Total Scaffold Genes | 97 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 86 (88.66%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Cellulose-Adapted → Mesophilic And Thermophilic Cellulose-Adapted Microbial Communities From The Joint Bioenergy Institute, California, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA, Joint Bio-Energy Institute | |||||||
| Coordinates | Lat. (o) | 37.8408 | Long. (o) | -122.2896 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F036417 | Metagenome / Metatranscriptome | 170 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0068702_10004154 | F036417 | AGG | LPRRRGFAICFRAMVYPARVPLRTRIPTVLVRLATDDGEVVFRARWTRSPLELQRNILFRMRRGSLLWFQDEWGHDLCFRPECVYAAMVDGR* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |