Basic Information | |
---|---|
Taxon OID | 3300005220 Open in IMG/M |
Scaffold ID | Ga0073352_1401 Open in IMG/M |
Source Dataset Name | Norris Geyser Basin Crystal Spring 9 - Microbial communities from the Yellowstone National Park, bulk metagenomes as controls for mini-metagenomic methods |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Stanford University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 916 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Adnaviria → Zilligvirae → Taleaviricota → Tokiviricetes → Ligamenvirales → Lipothrixviridae → Deltalipothrixvirus → Acidianus filamentous virus 2 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Hotspring → Microbial Communities From The Yellowstone National Park, Bulk Metagenomes As Controls For Mini-Metagenomic Methods |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Yellowstone National Park, Wyoming, USA | |||||||
Coordinates | Lat. (o) | 44.7287 | Long. (o) | -110.714783 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F071411 | Metagenome / Metatranscriptome | 122 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0073352_14011 | F071411 | N/A | MSEGDDKMLDILINSADNRTELEKHMDNIAQDLKDNLDDVIENAIDVQLYIDLSTKEPTGFDIGIVIGGPGIRLVYSRGTCKLQGAWGSLNDEKDVDNEICETILDYLTEMYRQ* |
⦗Top⦘ |