Scaffold Ga0073353_1019999

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0073353_1019999

Scaffold Ga0073353_1019999

Overview

Basic Information
Taxon OID	3300005225 Open in IMG/M
Scaffold ID	Ga0073353_1019999 Open in IMG/M
Source Dataset Name	Hotspring Microbial Communities from Lower Geyser Basin, Spring Unknown 43 (Mound Spring), Yellowstone National Park, Wyoming, USA ? Sample 3, bulk metagenomes as controls for mini-metagenomic methods
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Stanford University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	919
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Near-Boiling (>90C) → Alkaline → Hotspring → Microbial Communities From The Yellowstone National Park, Bulk Metagenomes As Controls For Mini-Metagenomic Methods

Source Dataset Sampling Location
Location Name	Yellowstone National Park, Wyoming, USA
Coordinates	Lat. (^o)	44.564833	Long. (^o)	-110.86325	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085286	Metagenome / Metatranscriptome	111	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0073353_10199991	F085286	AGGAGG	MAKMVVPMDTLQQLLQQARMSGNAELVAQLEQAIRDAKPVKNPNAIDDWDDAREAFQAGNLTIKKEAVREAARVLFAIADQTPQYREKVLQLFSRAMRNGES*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.