Basic Information | |
---|---|
Taxon OID | 3300005257 Open in IMG/M |
Scaffold ID | Ga0074076_101446 Open in IMG/M |
Source Dataset Name | Hot spring microbial communities from Beowulf Spring, Yellowstone National Park, Wyoming, USA - YNP_Beowulf Spring_D |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2804 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (83.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Wyoming | |||||||
Coordinates | Lat. (o) | 44.733 | Long. (o) | -110.709 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F042427 | Metagenome / Metatranscriptome | 158 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0074076_1014465 | F042427 | AGG | MSNLETQTSNSGGATNSVPLPLTLPGCECPCHVGGEPILCGAMCWHPQLDADKYVVELTSSTNNVDHYVQLLAVYSGGKLRYLVFDPSNGSARRFEVV* |
⦗Top⦘ |