Basic Information | |
---|---|
Taxon OID | 3300005275 Open in IMG/M |
Scaffold ID | Ga0065719_120935 Open in IMG/M |
Source Dataset Name | Hot spring sediment microbial communities from Great Boiling Spring, Nevada - Cellulolytic enrichment CS 85C |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1331 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring → Hot Spring Microbial Communities From Great Boiling Spring, Nevada |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Great Boiling Spring, Nevada | |||||||
Coordinates | Lat. (o) | 40.67 | Long. (o) | -119.37 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F080678 | Metagenome | 115 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0065719_1209354 | F080678 | GGAGG | MFVKKVDVRTVPITQAYENWECIWLGEREIRRFLAYTGLTAPPYNLRVENFLKFPFLRGMTARRFVQKLRRLGVTWNNDVMRRSILLAIGYRLLEIEEFEHYRIFGRKEVSVNV* |
⦗Top⦘ |