NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0065696_1221984

Scaffold Ga0065696_1221984


Overview

Basic Information
Taxon OID3300005280 Open in IMG/M
Scaffold IDGa0065696_1221984 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere microbial community from Michigan, USA - East Lansing bulk soil
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)515
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere Bulk Soil → Switchgrass Rhizosphere Bulk Soil Microbial Community From Michigan, Us

Source Dataset Sampling Location
Location NameEast Lansing, MI
CoordinatesLat. (o)42.704677Long. (o)-84.468818Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F065366Metagenome / Metatranscriptome127Y

Sequences

Protein IDFamilyRBSSequence
Ga0065696_12219842F065366N/AMFVVQLLGPSGARWKSSMDVTVVVELASRIQDLVQNESSELLAHSVDPISRVTFIPI*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.