Scaffold Ga0065720_1007415

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0065720_1007415

Scaffold Ga0065720_1007415

Overview

Basic Information
Taxon OID	3300005281 Open in IMG/M
Scaffold ID	Ga0065720_1007415 Open in IMG/M
Source Dataset Name	Thermophilic microbial communities from the Joint Bioenergy Institute, California, USA of rice/straw/compost enrichment - eDNA_2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	3726
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (20.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Grass → Composting → Bioreactor → Rice-Straw Enriched Compost → Rice-Straw Enriched Compost Microbial Community From Berkeley

Source Dataset Sampling Location
Location Name	Davis, California, USA
Coordinates	Lat. (^o)	38.5402727	Long. (^o)	-121.7500776	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003125	Metagenome / Metatranscriptome	506	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0065720_10074153	F003125	N/A	MDPFRILKQTWSVGDTIEVEAYRVERQVGLEYDSYRCVYLAHGHEWQIAGQIAKDDGKKYYLLECVA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.