NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0072500_150339

Scaffold Ga0072500_150339


Overview

Basic Information
Taxon OID3300005300 Open in IMG/M
Scaffold IDGa0072500_150339 Open in IMG/M
Source Dataset NameHot spring microbial communities from Great Boiling Spring, Nevada - cellulolytic enrichment S 77C
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)24117
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)16 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Great Boiling Spring, Nevada

Source Dataset Sampling Location
Location NameGreat Boiling Spring, Nevada
CoordinatesLat. (o)40.71458Long. (o)-119.369659Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F063403Metagenome / Metatranscriptome129N

Sequences

Protein IDFamilyRBSSequence
Ga0072500_1503396F063403AGGAGGMEGNINRTEALRELRAAIRSVRRTPIKIPFGNSDKFFIEIRIPKFSERLDIQMAAELFLGGFDSSERLVKSLPPLITSFRLPAEDEEGNLMQAVYNAEPLPDLPVLQLEPSDLFSDESAFNATPVLMTLIITTLLTLSGRTQNVAAGMNELLELFPGTNQNATDLLDKGSSRVSGSE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.