NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066860_10122616

Scaffold Ga0066860_10122616


Overview

Basic Information
Taxon OID3300005399 Open in IMG/M
Scaffold IDGa0066860_10122616 Open in IMG/M
Source Dataset NameMarine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F14-07SV275
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)912
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Microbial And Viral Regulation Of Community Carbon Cycling Across Diverse Low-Oxygen Zones

Source Dataset Sampling Location
Location NamePacific Ocean: Eastern Tropical North Pacific
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F082802Metagenome113Y
F099118Metagenome / Metatranscriptome103Y

Sequences

Protein IDFamilyRBSSequence
Ga0066860_101226161F099118AGGAGMSQEYYDHLNEGEKYACDKCDVVNLSATEYDSYIIMQYHYCESCWNYVHLKKGTC
Ga0066860_101226162F082802N/ATLDKKQIAKIKARLPEYKRGSSMIGHGTSQCSYSLQTMQMISDSPLSRMKQCLAQIDKKYKALQEAYYNIEKKKLTIERLKKQTDAHSRLTVQEYESQIESITMSMNAALREIGMFQDMYDGIKKNNNIPDNWNEKDFEKQEIANMVRSSFRLSIQDLSASGRVSKAVVEYWEQLGIHPQLAETRTRSYLVLIQEKINSSATVTIRDMYKFLDDMADEFKDSHQDALSRIGLDELGSEGFMAQGVTKPQ*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.