NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0068706_1067733

Scaffold Ga0068706_1067733


Overview

Basic Information
Taxon OID3300005452 Open in IMG/M
Scaffold IDGa0068706_1067733 Open in IMG/M
Source Dataset NameAnoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)633
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic → Anoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa

Source Dataset Sampling Location
Location NameUSA: Wyoming: Yellowstone National Park
CoordinatesLat. (o)44.963Long. (o)-110.715Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F081383Metagenome / Metatranscriptome114N

Sequences

Protein IDFamilyRBSSequence
Ga0068706_10677332F081383N/ALAQTFFLGGTSPQRTRSVGRGRAKCPSYHSLVLHPPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHLKSKAFLM*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.