NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0070741_10000189

Scaffold Ga0070741_10000189


Overview

Basic Information
Taxon OID3300005529 Open in IMG/M
Scaffold IDGa0070741_10000189 Open in IMG/M
Source Dataset NameSurface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)230580
Total Scaffold Genes202 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)163 (80.69%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil → Surface Soil Microbial Communities From Centralia Pennsylvania, Which Are Recovering From An Underground Coalmine Fire.

Source Dataset Sampling Location
Location NameUSA: Pennsylvania, Centralia
CoordinatesLat. (o)40.7999Long. (o)-76.3402Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036814Metagenome / Metatranscriptome169Y
F057533Metagenome / Metatranscriptome136Y
F070325Metagenome / Metatranscriptome123Y
F084500Metagenome / Metatranscriptome112Y

Sequences

Protein IDFamilyRBSSequence
Ga0070741_10000189124F070325N/AMALSDGMECPHCQTRLEVANGTRMIATTAGLIAGGIVWWATVSTPNILGFALPVLLSFLTLGIVSPLVLMFTAALRTAPATPVSEPGAAPGGHGQAAHGHAGGGHH*
Ga0070741_10000189133F084500GGAGGLNSQWWNVWKSWLSFILPLTGGLIAAGVGFRMLILTDFSNSGWEFMGRCGADALGFFLVAGICWLKTHPELDSED*
Ga0070741_10000189180F036814AGGAGGMKINVTREDITSGKPGKPTECMVALALKRELGVSYASVGYDEAKILMDGQYIKLYFSKKVEKKIRFWDGFHFVFPFSFELVPSGYLTGRTIELQETQSRLADDLLAVPQGA*
Ga0070741_1000018957F057533AGGMPKQARVAILMIAIVIFAVAMLNLVRSKVEASGRALKSAAVQYSSLKKIYTPEKLVQTVSGTSLQVSPNAR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.