NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066670_10539095

Scaffold Ga0066670_10539095


Overview

Basic Information
Taxon OID3300005560 Open in IMG/M
Scaffold IDGa0066670_10539095 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)714
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027153Metagenome195Y
F099098Metagenome / Metatranscriptome103Y

Sequences

Protein IDFamilyRBSSequence
Ga0066670_105390951F099098GAGMSDYSQKVTGSFNERMRLNRLRRRKEKLRFWSEFLIIPKWLMGLVA
Ga0066670_105390952F027153N/AARCASERCSMSENLHERALQLVAKARVEGLADSEREWLTVHLQDCDFCNEHAQQIDCALRSLRTAAIPVPADLASRTQFRVRLRAMELREREPKRRMLWLACAASWIFGIASAPYVWRIFEWFGHVTGAPKLLLEIGFGLWWTIPALFAVIVLLLESARQTEEPEWMKPSR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.