Basic Information | |
---|---|
Taxon OID | 3300005647 Open in IMG/M |
Scaffold ID | Ga0079203_1120897 Open in IMG/M |
Source Dataset Name | Marine algae microbial communities from Bantry Bay - Bantry Bay, Ireland |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 809 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Genome And Metagenome Analysis Of Marine Red Algae Porphyra |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Bantry Bay, Ireland | |||||||
Coordinates | Lat. (o) | 51.64 | Long. (o) | -9.71 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F100273 | Metagenome | 102 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0079203_11208972 | F100273 | N/A | TILASEYNHPGDRRHRLSERVRKIDLDSCLKDSIVDDGLDYFE* |
⦗Top⦘ |