NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0078894_10040197

Scaffold Ga0078894_10040197


Overview

Basic Information
Taxon OID3300005662 Open in IMG/M
Scaffold IDGa0078894_10040197 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3910
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (66.67%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameLake Michigan, USA
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000671Metagenome / Metatranscriptome945Y
F013891Metagenome / Metatranscriptome267Y
F073544Metagenome / Metatranscriptome120Y
F077310Metagenome / Metatranscriptome117Y

Sequences

Protein IDFamilyRBSSequence
Ga0078894_1004019710F000671GAGGMEKILCYCCNKTKNKLNVRKSVLIPINLLMCETCITSKFEPRWVVILAGRQLGSDSVKEFIIKKRYCGNDIAASELLV*
Ga0078894_1004019711F073544AGGVLEYYEVIKIVFIHAERLYGSVESLGLYASKVKYQKDGIEIEEVLENDEFTIMDEIIFEHVEGSN*
Ga0078894_1004019712F013891N/AQMDIAKYPEFLAIRLYEDNFVKYEGIKKEMVIDYVGKVKKLIESYGVRCELEGVPSARILRSN*
Ga0078894_100401979F077310N/AMTLDSNSVIIVIVASILSGMGTALVKEIKESKREKIRRAEREQDMLKMELKDLEIKLYKLEKDLTEWRDRYYEALQELIEVKAELEDTLIKLNHIVMHE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.