Basic Information | |
---|---|
Taxon OID | 3300005767 Open in IMG/M |
Scaffold ID | Ga0078197_123226 Open in IMG/M |
Source Dataset Name | Human lung microbial communities from HIV infected subject HIV3-1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | New York University Langone Medical Center |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 524 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Respiratory System → Lung → Unclassified → Lung Microbiome → Human Lung Microbial Communites From Healthy (Non-Smokers And Smokers) And Hiv Infected Subjects |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | New York City, New York, USA | |||||||
Coordinates | Lat. (o) | 40.7127 | Long. (o) | -74.0059 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F077438 | Metagenome / Metatranscriptome | 117 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0078197_1232261 | F077438 | N/A | DEPSFRKSRFETLFLWSFHVEISIALRPKVEKETSSYKN* |
⦗Top⦘ |