Scaffold Ga0081519_100406

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0081519_100406

Scaffold Ga0081519_100406

Overview

Basic Information
Taxon OID	3300005963 Open in IMG/M
Scaffold ID	Ga0081519_100406 Open in IMG/M
Source Dataset Name	Hot spring microbial streamer communities from Conch Spring, Yellowstone National Park, USA - C T=80-84
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	7344
Total Scaffold Genes	10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (40.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Pyrobaculum → unclassified Pyrobaculum → Pyrobaculum sp.	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location Name	Conch Spring, Yellowstone National Park, Wyoming, USA
Coordinates	Lat. (^o)	44.5564135	Long. (^o)	-110.8321631	Alt. (m)		Depth (m)	2194.56
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013155	Metagenome / Metatranscriptome	274	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0081519_1004069	F013155	N/A	MELYQIIIVAIALVNLAVAVWLLRLIIPVWQTLRKVVFVVDQYDFDKLAKQFLNGEKPLSETIHIKATENKEEGYKEIIITRAYKRPLDPREVQENFVRQMAEKLQ*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.