NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0081478_153999

Scaffold Ga0081478_153999


Overview

Basic Information
Taxon OID3300005966 Open in IMG/M
Scaffold IDGa0081478_153999 Open in IMG/M
Source Dataset NameHot spring and microbial mat streamer communities from Octopus Spring Streamers, Yellowstone National Park, USA - T=80-84
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1182
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring And Microbial Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameOctopus Spring Streamers, Yellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.5340836Long. (o)-110.7978895Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F069506Metagenome124N
F086364Metagenome111N

Sequences

Protein IDFamilyRBSSequence
Ga0081478_1539992F086364AGGAGGMEREKIIAALETAFADISGAEYEDEPTTFAEFLESFAKLRDPDFPVYWIPWTVEEAVEELTGRKFGWHEDVLKDEWSYTGEFSFICVDPETLKCLTAERSNGSCTVSVVFPILSIDDAVQVVEYFLRLVQQA*
Ga0081478_1539993F069506GGAGGMQLEQQTFTEEQIKQAIEEVWQELLQETDAENYSLEEYLEDYRKYWYDTCFPNDIPELIMRTVEKLIGRPLSWYCELVRDPAGFTGEYSFVVVDPKTQKCLTYREYTSDGVNVHRFIHVAGTVIYYEDIVRLVTKLLNQIQSALANA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.