NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0097691_1000321

Scaffold Ga0097691_1000321


Overview

Basic Information
Taxon OID3300006055 Open in IMG/M
Scaffold IDGa0097691_1000321 Open in IMG/M
Source Dataset NameArctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)43666
Total Scaffold Genes44 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)24 (54.55%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location
Location NameBarrow Environmental Observatory site, Barrow, Alaska
CoordinatesLat. (o)71.2999Long. (o)-156.61Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049308Metagenome147Y
F066982Metagenome / Metatranscriptome126Y

Sequences

Protein IDFamilyRBSSequence
Ga0097691_100032124F049308N/AMAPDDKECKQCGWDLSKNAPPTTDPGDNKARLGVVAGLVVAYGVMSFLIQGSPAEAREEPVRAPQYTDAPALTTEPVNGPEMAIGTLPQAVPSTAASIASSALISIKVADTKGASIQPRDALQYKFELPETDQKCRLVGSTKGIGGFGRNIEVFLLTDDDYVFWHANPAAIAASQWETFRGSETTLDYALPGPGTYHFVVSNQMSPTPQTVAVKAQVTCAR*
Ga0097691_100032125F066982N/AMIYTGFSMDPQTFEASPIEEMDPIECPACHQTHRWNKRDARFERDPNE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.