NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0081425_139657

Scaffold Ga0081425_139657


Overview

Basic Information
Taxon OID3300006065 Open in IMG/M
Scaffold IDGa0081425_139657 Open in IMG/M
Source Dataset NameHotspring Microbial Communities from Lower Geyser Basin, Spring Unknown 43 (Mound Spring), Yellowstone National Park, Wyoming, USA ? Sample 3, Mini-Metagenomics
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterStanford University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3000
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (100.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Halobacteriales → Halobacteriaceae → Haladaptatus → Haladaptatus paucihalophilus → Haladaptatus paucihalophilus DX253(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Near-Boiling (>90C) → Alkaline → Hotspring → Mini-Metagenome - Microbial Communities From The Yellowstone National Park

Source Dataset Sampling Location
Location NameYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.564833Long. (o)-110.86325Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003460Metagenome / Metatranscriptome485Y
F004367Metagenome / Metatranscriptome441Y
F076662Metagenome / Metatranscriptome118Y

Sequences

Protein IDFamilyRBSSequence
Ga0081425_1396572F004367AGGAGGMGNQTNGNGRDNGDRWTEGLLTGAGASVSLVLDDRQRHAVNLALEVFAYLLAALPSETVLTVDVIRFLKWYSRGINNAKSE*
Ga0081425_1396573F003460AGGGGGMPRASRNERYMHDLQHVYESLYDVLAPRGLYPEAFLLLVVNLRRPGELRDVAIELVVRARAGGSPVWRAHDSLRVPGRMKLRSLADALCGLMLRATYDIEALVPLPGSDRERHQGGARA*
Ga0081425_1396575F004367AGGAGGMGNQTNGNGRVNGDRWTEGLLTGAGASVSLVLDDRQRHAVNLALEVFAYLLAALPSETVLTVDVIRFLKWYSRGINNAKSE*
Ga0081425_1396576F076662AGGGGGMPKASRNERYMHDLQHVYESLYDVLSPRGLYPEAFLLLVVNLRRPGELRDVALELVVRARAGGSPVWRAHDSLRVPGRMKLRSLA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.