Scaffold Ga0081425_156126

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0081425_156126

Scaffold Ga0081425_156126

Overview

Basic Information
Taxon OID	3300006065 Open in IMG/M
Scaffold ID	Ga0081425_156126 Open in IMG/M
Source Dataset Name	Hotspring Microbial Communities from Lower Geyser Basin, Spring Unknown 43 (Mound Spring), Yellowstone National Park, Wyoming, USA ? Sample 3, Mini-Metagenomics
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Stanford University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3759
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (71.43%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Near-Boiling (>90C) → Alkaline → Hotspring → Mini-Metagenome - Microbial Communities From The Yellowstone National Park

Source Dataset Sampling Location
Location Name	Yellowstone National Park, Wyoming, USA
Coordinates	Lat. (^o)	44.564833	Long. (^o)	-110.86325	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019254	Metagenome	231	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0081425_1561264	F019254	AGG	MPSEKIREALFYLQDDWPIRVLLSTLAERVAELAALLGRAEAQKLSPEFLTRIRAIEEEMHALSRPCQNPPLPHRGNARRKVDNLPLF*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.