NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0082045_10115

Scaffold Ga0082045_10115


Overview

Basic Information
Taxon OID3300006157 Open in IMG/M
Scaffold IDGa0082045_10115 Open in IMG/M
Source Dataset NameMarine microbial communities from the Red Sea brine-pool Kebit Deep Lower-Interfase
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterKing Abdullah University of Science and Technology
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)1579
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Altiarchaeota → Candidatus Altiarchaeales → unclassified Candidatus Altiarchaeales → Candidatus Altiarchaeales archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Red Sea Brine-Pools

Source Dataset Sampling Location
Location NameRed Sea
CoordinatesLat. (o)24.7187Long. (o)36.2888Alt. (m)Depth (m)1469
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F076704Metagenome117N

Sequences

Protein IDFamilyRBSSequence
Ga0082045_101151F076704N/ASAKNESIWNGGRDPLANSLSVDTSVDIEKISVVGRRNPVSLIEGTQELTGSLERNLYSANASYNDIIYENDTTHHELLSATGVYGGSISTCKIILNTTSNEPSADYNRVIYGVKFHSYSTSIASGETVTESVDYSATNLSTS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.