NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0078977_103885

Scaffold Ga0078977_103885


Overview

Basic Information
Taxon OID3300006409 Open in IMG/M
Scaffold IDGa0078977_103885 Open in IMG/M
Source Dataset NameViral communities from the deep bioline of CORK borehole observatory U136A, on the Juan de Fuca Ridge Flank, Pacific Ocean - passive in situ filtration, Fraction 20
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Hawaii
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)781
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Viruses Inhabiting Crustal Fluids Of The Juan De Fuca Ridge Flank

Source Dataset Sampling Location
Location NameJuan de Fuca Ridge Flank, Pacific Ocean
CoordinatesLat. (o)47.750184Long. (o)-127.740187Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051940Metagenome143Y

Sequences

Protein IDFamilyRBSSequence
Ga0078977_1038851F051940GGAGGVKLLENLIKFLRNDNADVQMIGVVIGILVTLIVAVLVFYNIAGSIDTEDIDAKLTGTPAENATDATLDQAGTFFSIAPIIAIVIVAVVILGYVSRIGGGG*
Ga0078977_1038852F051940AGGCGGMKLLQIIKQLLRGDNANIQMIGGVVAILVTLIVAVLVFYNIAGSIDTEDIDKNFGGENETPAENATEATMDQAGTFFSIAPIIAIVAVAVVILGYVTRIGG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.