Basic Information | |
---|---|
Taxon OID | 3300006409 Open in IMG/M |
Scaffold ID | Ga0078977_106242 Open in IMG/M |
Source Dataset Name | Viral communities from the deep bioline of CORK borehole observatory U136A, on the Juan de Fuca Ridge Flank, Pacific Ocean - passive in situ filtration, Fraction 20 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Hawaii |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 605 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Korarchaeota → Candidatus Korarchaeota archaeon | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Viruses Inhabiting Crustal Fluids Of The Juan De Fuca Ridge Flank |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Juan de Fuca Ridge Flank, Pacific Ocean | |||||||
Coordinates | Lat. (o) | 47.750184 | Long. (o) | -127.740187 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F103293 | Metagenome | 101 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0078977_1062422 | F103293 | GGAGG | MINIEKLKMLPPPYEIYEFVPCQPAYFKIVDVEMGRMTITPRFPGAPPRKEILAIRLHVDPKTKPFFPHYWDITPSRLVHQLAAMLLPTFPAEMWLRIHRDIPGPKAHFSVGWVEKPP* |
⦗Top⦘ |